Signal Peptide Database - Mammalia

 Entry Details
ID   17551
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P11279    (Created: 1989-07-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   LAMP1_HUMAN
Protein Name   Lysosome-associated membrane glycoprotein 1
Gene   LAMP1
Organism Scientific   Homo sapiens
Organism Common   Human
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Hominidae
                          Homo
Protein Length [aa]   417
Protein Mass [Da]   44882
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   28
chain   Lysosome-associated membrane glycoprotein 1      29   417
disulfide bond         41   80
disulfide bond         155   191
disulfide bond         231   269
disulfide bond         338   375
transmembrane region      potential   383   405
topological domain   Lumenal   potential   29   382
topological domain   Cytoplasmic   potential   406   417
region of interest   First lumenal domain      29   194
region of interest   Hinge      195   227
region of interest   Second lumenal domain      228   382
glycosylation site   N-linked (GlcNAc...)      37   37
glycosylation site   N-linked (GlcNAc...)      45   45
glycosylation site   N-linked (GlcNAc...) (polylactosaminoglycan)      62   62
glycosylation site   N-linked (GlcNAc...)      76   76
glycosylation site   N-linked (GlcNAc...)      84   84
glycosylation site   N-linked (GlcNAc...)      103   103
glycosylation site   N-linked (GlcNAc...)      107   107
glycosylation site   N-linked (GlcNAc...) (polylactosaminoglycan)      121   121
glycosylation site   N-linked (GlcNAc...) (polylactosaminoglycan)      130   130
glycosylation site   N-linked (GlcNAc...)      165   165
glycosylation site   N-linked (GlcNAc...)      181   181
glycosylation site   O-linked (GalNAc...); partial      197   197
glycosylation site   O-linked (GalNAc...)      199   199
glycosylation site   O-linked (GalNAc...)      200   200
glycosylation site   O-linked (GalNAc...)      207   207
glycosylation site   O-linked (GalNAc...)      209   209
glycosylation site   O-linked (GalNAc...)      211   211
glycosylation site   N-linked (GlcNAc...) (polylactosaminoglycan)      223   223
glycosylation site   N-linked (GlcNAc...) (polylactosaminoglycan)      228   228
glycosylation site   N-linked (GlcNAc...)      241   241
glycosylation site   N-linked (GlcNAc...)      249   249
glycosylation site   N-linked (GlcNAc...)      261   261
glycosylation site   N-linked (GlcNAc...)      293   293
glycosylation site   N-linked (GlcNAc...)      322   322
sequence variant   (in dbSNP:rs9577230)      0   0
SP Length   28
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MAAPGSARRPLLLLLLLLLLGLMHCASA
Sequence MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAF
SVNYDTKSGPK
NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTL
TL
NFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADID
KKYRCVSGTQVHMN
NVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTT
APPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNT
TVTRLLNINP
NKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF
LQGIQLNTILPDARDPAFKAA
NGSLRALQATVGNSYKCNAEEHVRVTKAF
SVNIFKVWVQAFKVEGGQFGSVEECLLDENSM
LIPIAVGGALAGLVLIVL
IAYLV
GRKRSHAGYQTI
Original MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAF
SVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTL
TLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADID
KKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTT
APPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNT
TVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF
LQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAF
SVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVL
IAYLVGRKRSHAGYQTI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11